PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 175aa    MW: 19705.2 Da    PI: 8.865
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020993genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.21.7e-3660135177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqve+C +dls+ k y+rrhkvC+ h+ka vv ++g++qrfCqqCsrfhel+efD++krsCrrrLa+hnerrrk +
  DCAR_020993  60 RCQVESCCVDLSDEK-YYRRHKVCQLHAKALVVGLAGKQQRFCQQCSRFHELTEFDNAKRSCRRRLAGHNERRRKCS 135
                  6***********975.99********************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3057121IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.63E-3358137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.35958134IPR004333Transcription factor, SBP-box
PfamPF031104.9E-2961133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MTSKIHSKPA DNNNLPSITL AFTDVEEGED VSSLGFEKGS CRKKESVFLN AAYGNVVPPR  60
CQVESCCVDL SDEKYYRRHK VCQLHAKALV VGLAGKQQRF CQQCSRFHEL TEFDNAKRSC  120
RRRLAGHNER RRKCSSESHK EGSNSQLKDG HRQADERGSA LLEKPSSEKY LRIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30611331184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260271.16e-42PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387408e-37SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A061FF192e-40A0A061FF19_THECC; Squamosa promoter binding protein-like 3 isoform 2 (Fragment)
TrEMBLA0A0D2RE062e-40A0A0D2RE06_G
STRINGPOPTR_0001s40870.11e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.19e-38squamosa promoter binding protein-like 5